PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30129.m000351
Common NameRCOM_1439360
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family NF-YB
Protein Properties Length: 117aa    MW: 13344.9 Da    PI: 6.5162
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30129.m000351genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB110.21.2e-341621778
          NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfed 78
                   mk++lP+nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++walatlG+ +
  30129.m000351  1 MKQILPSNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWALATLGYRE 62
                   9**********************************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.7E-30165IPR009072Histone-fold
SuperFamilySSF471131.39E-24178IPR009072Histone-fold
PfamPF008081.7E-21155IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.6E-111937No hitNo description
PROSITE patternPS0068502238IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.6E-113856No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 117 aa     Download sequence    Send to blast
MKQILPSNAK ISKEAKETMQ ECVSEFISFV TGEASDKCHK EKRKTVNGDD ICWALATLGY  60
REQEGERAGH KSSNSEEKQD SMVDYNGEQS RKFTAPIQLK FPEVFDRSEN SSVCRRF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-251601776Transcription factor HapC (Eurofung)
4g92_B1e-251601776Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR2322752e-57KR232275.1 Vernicia fordii nuclear transcription factor Y subunit B-9 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015582511.12e-79PREDICTED: nuclear transcription factor Y subunit B-4
SwissprotO822484e-37NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLB9T0U21e-83B9T0U2_RICCO; Ccaat-binding transcription factor subunit A, putative
STRINGPOPTR_0014s12710.16e-46(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.12e-38nuclear factor Y, subunit B5